PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g010900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 329aa    MW: 36577.8 Da    PI: 9.7558
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g010900.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.51.6e-151603999
                    EETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 39 edesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                    +de+g+sW++ l+++kksg+ + ++GW++F++ ng+k+g  + Fkl++ s++++v++++ +
  Csa10g010900.1  1 MDEDGKSWTLLLRHNKKSGQAFVRGGWRKFCRNNGIKAGSLCRFKLVQ-SGTKPVLQLCPN 60
                    599*******************************************98.99999*999975 PP

2B3376.1e-12107197699
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--.TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk.egDfvvFkldgrsefelvvkvfrk 99 
                     +++++  s+++++p + a+e+g+ k++  ++t+ +++g++W+  l   k++++++++   keF  ang+k +gD +++++++  ++++ +k+++k
  Csa10g010900.1 107 LKPYMIGSSQFRVPASLARENGILKAG--EVTVLNKDGEEWKSHLVNVKGRDQFYIR-SCKEFFLANGIKnVGDPFTLEVIR-GGTSPILKICSK 197
                     5678889999***********999877..7***************888999999999.99**********9********997.88889****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.62160IPR003340B3 DNA binding domain
PfamPF023623.1E-14160IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.2E-13160IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.9E-4161IPR003340B3 DNA binding domain
SuperFamilySSF1019361.16E-14164IPR015300DNA-binding pseudobarrel domain
CDDcd100176.98E-15159No hitNo description
Gene3DG3DSA:2.40.330.104.2E-899197IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-8100196IPR015300DNA-binding pseudobarrel domain
CDDcd100171.26E-8101196No hitNo description
SMARTSM010193.9E-17102198IPR003340B3 DNA binding domain
PROSITE profilePS508636.456102198IPR003340B3 DNA binding domain
PfamPF023627.0E-12107197IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MDEDGKSWTL LLRHNKKSGQ AFVRGGWRKF CRNNGIKAGS LCRFKLVQSG TKPVLQLCPN  60
TSSIPEGNSS KANKKGNVSE SEGDEIETED CSETVPVLQN KILTLDLKPY MIGSSQFRVP  120
ASLARENGIL KAGEVTVLNK DGEEWKSHLV NVKGRDQFYI RSCKEFFLAN GIKNVGDPFT  180
LEVIRGGTSP ILKICSKVKQ VSFDGYKTLE RKPRMTVQAP HAEDETENRV QKKARVCTEG  240
GPSRCTRALN KSSTDPGNLQ RKQPLQPCSI SDHVKKVRQS IMDTLTDVRR FRSELEIKEQ  300
NLQASLHEID ALGEKIMGIS QIFNISQA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0310044e-98AL031004.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F28M20 (ESSAII project).
GenBankAL1615794e-98AL161579.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 75.
GenBankCP0026874e-98CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432841.10.0PREDICTED: putative B3 domain-containing protein REM4 isoform X1
SwissprotQ9SB791e-176REM4_ARATH; Putative B3 domain-containing protein REM4
TrEMBLR0GW330.0R0GW33_9BRAS; Uncharacterized protein
STRINGAT4G31630.11e-173(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96581537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31630.11e-177B3 family protein